Anti ADAMTS5 pAb (ATL-HPA030906)

Atlas Antibodies

Catalog No.: ATL-HPA030906-25

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 5
Gene Name: ADAMTS5
Alternative Gene Name: ADAMTS11, ADMP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022894: 90%, ENSRNOG00000057794: 88%
Entrez Gene ID: 11096
Uniprot ID: Q9UNA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
• Gene Sequence: KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
• Gene ID - Mouse: ENSMUSG00000022894
• Gene ID - Rat: ENSRNOG00000057794
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.