Anti ADAMTS4 pAb (ATL-HPA051296)

Atlas Antibodies

Catalog No.: ATL-HPA051296-25

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 4
Gene Name: ADAMTS4
Alternative Gene Name: ADAMTS-2, ADMP-1, KIAA0688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 95%, ENSRNOG00000003538: 92%
Entrez Gene ID: 9507
Uniprot ID: O75173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
• Gene Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
• Gene ID - Mouse: ENSMUSG00000006403
• Gene ID - Rat: ENSRNOG00000003538
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.