Anti ADAMTS2 pAb (ATL-HPA028444)

Atlas Antibodies

Catalog No.: ATL-HPA028444-25

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 2
Gene Name: ADAMTS2
Alternative Gene Name: ADAM-TS2, ADAMTS-3, hPCPNI, NPI, PCINP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036545: 72%, ENSRNOG00000061484: 71%
Entrez Gene ID: 9509
Uniprot ID: O95450
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPSNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLG
• Gene Sequence: VAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPSNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLG
• Gene ID - Mouse: ENSMUSG00000036545
• Gene ID - Rat: ENSRNOG00000061484
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.