Anti ADAMTS17 pAb (ATL-HPA062487)

Atlas Antibodies

Catalog No.: ATL-HPA062487-25

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 17
Gene Name: ADAMTS17
Alternative Gene Name: FLJ16363, FLJ32769
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058145: 88%, ENSRNOG00000037080: 89%
Entrez Gene ID: 170691
Uniprot ID: Q8TE56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS
• Gene Sequence: QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS
• Gene ID - Mouse: ENSMUSG00000058145
• Gene ID - Rat: ENSRNOG00000037080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.