Anti ADAM30 pAb (ATL-HPA026080 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026080-100

Protein Description: ADAM metallopeptidase domain 30
Gene Name: ADAM30
Alternative Gene Name: svph4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043468: 61%, ENSRNOG00000019044: 60%
Entrez Gene ID: 11085
Uniprot ID: Q9UKF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RCFRKGCRSRYMQCQSIFGPDAMEAPSECYDAVNLIGDQFGNCEITGIRNFKKCESANSICGRLQCINVETIPDLPEHTTIISTHLQAENLMCWGTGYHLSMKPMGIPDLGMINDGTSCG
• Gene Sequence: RCFRKGCRSRYMQCQSIFGPDAMEAPSECYDAVNLIGDQFGNCEITGIRNFKKCESANSICGRLQCINVETIPDLPEHTTIISTHLQAENLMCWGTGYHLSMKPMGIPDLGMINDGTSCG
• Gene ID - Mouse: ENSMUSG00000043468
• Gene ID - Rat: ENSRNOG00000019044
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.