Anti ACYP1 pAb (ATL-HPA034944 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034944-25

Protein Description: acylphosphatase 1, erythrocyte (common) type
Gene Name: ACYP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008822: 91%, ENSRNOG00000006744: 89%
Entrez Gene ID: 97
Uniprot ID: P07311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQI
• Gene Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQI
• Gene ID - Mouse: ENSMUSG00000008822
• Gene ID - Rat: ENSRNOG00000006744
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.