Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA048187-25

Protein Description: aspartoacylase (aminocyclase) 3
Gene Name: ACY3
Alternative Gene Name: ACY-3, HCBP1, MGC9740
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024866: 72%, ENSRNOG00000017901: 75%
Entrez Gene ID: 91703
Uniprot ID: Q96HD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
• Gene Sequence: MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
• Gene ID - Mouse: ENSMUSG00000024866
• Gene ID - Rat: ENSRNOG00000017901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.