Anti ACTRT2 pAb (ATL-HPA025079 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025079-25

Protein Description: actin-related protein T2
Gene Name: ACTRT2
Alternative Gene Name: Arp-T2, ARPM2, FLJ25424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051276: 78%, ENSRNOG00000012586: 77%
Entrez Gene ID: 140625
Uniprot ID: Q8TDY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIVLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAP
• Gene Sequence: ALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIVLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAP
• Gene ID - Mouse: ENSMUSG00000051276
• Gene ID - Rat: ENSRNOG00000012586
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.