Anti ACTL7B pAb (ATL-HPA024664 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024664-25

Protein Description: actin-like 7B
Gene Name: ACTL7B
Alternative Gene Name: Tact1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070980: 86%, ENSRNOG00000016621: 86%
Entrez Gene ID: 10880
Uniprot ID: Q9Y614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSL
• Gene Sequence: LTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSL
• Gene ID - Mouse: ENSMUSG00000070980
• Gene ID - Rat: ENSRNOG00000016621
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.