Anti ACSM6 pAb (ATL-HPA044593)

Atlas Antibodies

Catalog No.: ATL-HPA044593-25

Protein Description: acyl-CoA synthetase medium-chain family member 6
Gene Name: ACSM6
Alternative Gene Name: bA310E22.3, C10orf129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030935: 43%, ENSRNOG00000032246: 48%
Entrez Gene ID: 142827
Uniprot ID: Q6P461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFCPETVLNVLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWKRITKL
• Gene Sequence: TFCPETVLNVLSRFPITTLSANPEMYQELLQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWKRITKL
• Gene ID - Mouse: ENSMUSG00000030935
• Gene ID - Rat: ENSRNOG00000032246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.