Anti ACRBP pAb (ATL-HPA039081 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039081-100

• 
• 

Protein Description: acrosin binding protein
Gene Name: ACRBP
Alternative Gene Name: CT23, OY-TES-1, SP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072770: 89%, ENSRNOG00000017399: 89%
Entrez Gene ID: 84519
Uniprot ID: Q8NEB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCS
• Gene Sequence: AQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCS
• Gene ID - Mouse: ENSMUSG00000072770
• Gene ID - Rat: ENSRNOG00000017399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.