Anti ACMSD pAb (ATL-HPA010533 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010533-25

Protein Description: aminocarboxymuconate semialdehyde decarboxylase
Gene Name: ACMSD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026348: 90%, ENSRNOG00000003884: 87%
Entrez Gene ID: 130013
Uniprot ID: Q8TDX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNAL
• Gene Sequence: GVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNAL
• Gene ID - Mouse: ENSMUSG00000026348
• Gene ID - Rat: ENSRNOG00000003884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.