Anti ACAT2 pAb (ATL-HPA025765 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025765-100

Protein Description: acetyl-CoA acetyltransferase 2
Gene Name: ACAT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062480: 86%, ENSRNOG00000019189: 86%
Entrez Gene ID: 39
Uniprot ID: Q9BWD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLS
• Gene Sequence: SIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLS
• Gene ID - Mouse: ENSMUSG00000062480
• Gene ID - Rat: ENSRNOG00000019189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.