Anti ABCC12 pAb (ATL-HPA043100)

Atlas Antibodies

Catalog No.: ATL-HPA043100-25

Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 12
Gene Name: ABCC12
Alternative Gene Name: MRP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036872: 86%, ENSRNOG00000015666: 84%
Entrez Gene ID: 94160
Uniprot ID: Q96J65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWLTPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRV
• Gene Sequence: GPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSFATFSWLTPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRV
• Gene ID - Mouse: ENSMUSG00000036872
• Gene ID - Rat: ENSRNOG00000015666
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.