Anti ZSWIM5 pAb (ATL-HPA018211)

Atlas Antibodies

Catalog No.: ATL-HPA018211-25

Protein Description: zinc finger, SWIM-type containing 5
Gene Name: ZSWIM5
Alternative Gene Name: KIAA1511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033948: 92%, ENSRNOG00000018160: 90%
Entrez Gene ID: 57643
Uniprot ID: Q9P217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPIDCLFLTLTEACRLNDDGYLEMSDMNESRPPVYQHVPVAAGSPNSSESYLSLALEVALMG
• Gene Sequence: QLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPIDCLFLTLTEACRLNDDGYLEMSDMNESRPPVYQHVPVAAGSPNSSESYLSLALEVALMG
• Gene ID - Mouse: ENSMUSG00000033948
• Gene ID - Rat: ENSRNOG00000018160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.