Anti ZSWIM4 pAb (ATL-HPA042084)

Atlas Antibodies

Catalog No.: ATL-HPA042084-25

Protein Description: zinc finger, SWIM-type containing 4
Gene Name: ZSWIM4
Alternative Gene Name: FLJ12221
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035671: 85%, ENSRNOG00000007582: 87%
Entrez Gene ID: 65249
Uniprot ID: Q9H7M6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLDPIGCLCRALLEACRLEEETLTLYPDSGPEKRKVAYQHVPVPGSPGESYLVL
• Gene Sequence: PLDPIGCLCRALLEACRLEEETLTLYPDSGPEKRKVAYQHVPVPGSPGESYLVL
• Gene ID - Mouse: ENSMUSG00000035671
• Gene ID - Rat: ENSRNOG00000007582
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.