Anti ZSCAN23 pAb (ATL-HPA035960)

Atlas Antibodies

Catalog No.: ATL-HPA035960-25

Protein Description: zinc finger and SCAN domain containing 23
Gene Name: ZSCAN23
Alternative Gene Name: dJ29K1.3.1, ZNF390, ZNF453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007812: 34%, ENSRNOG00000016562: 37%
Entrez Gene ID: 222696
Uniprot ID: Q3MJ62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVCPVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCDREGRLEKQRVS
• Gene Sequence: EVCPVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCDREGRLEKQRVS
• Gene ID - Mouse: ENSMUSG00000007812
• Gene ID - Rat: ENSRNOG00000016562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.