Anti ZPR1 pAb (ATL-HPA030979)

Atlas Antibodies

Catalog No.:
ATL-HPA030979-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ZPR1 zinc finger
Gene Name: ZPR1
Alternative Gene Name: ZNF259
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032078: 85%, ENSRNOG00000018481: 83%
Entrez Gene ID: 8882
Uniprot ID: O75312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQV
Gene Sequence RYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQV
Gene ID - Mouse ENSMUSG00000032078
Gene ID - Rat ENSRNOG00000018481
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZPR1 pAb (ATL-HPA030979)
Datasheet Anti ZPR1 pAb (ATL-HPA030979) Datasheet (External Link)
Vendor Page Anti ZPR1 pAb (ATL-HPA030979) at Atlas Antibodies

Documents & Links for Anti ZPR1 pAb (ATL-HPA030979)
Datasheet Anti ZPR1 pAb (ATL-HPA030979) Datasheet (External Link)
Vendor Page Anti ZPR1 pAb (ATL-HPA030979)