Anti ZNF846 pAb (ATL-HPA034617)

Atlas Antibodies

Catalog No.:
ATL-HPA034617-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 846
Gene Name: ZNF846
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068134: 42%, ENSRNOG00000006112: 42%
Entrez Gene ID: 162993
Uniprot ID: Q147U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEKLYDSNHSGKVFNEHPFLMTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHE
Gene Sequence AEKLYDSNHSGKVFNEHPFLMTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHE
Gene ID - Mouse ENSMUSG00000068134
Gene ID - Rat ENSRNOG00000006112
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF846 pAb (ATL-HPA034617)
Datasheet Anti ZNF846 pAb (ATL-HPA034617) Datasheet (External Link)
Vendor Page Anti ZNF846 pAb (ATL-HPA034617) at Atlas Antibodies

Documents & Links for Anti ZNF846 pAb (ATL-HPA034617)
Datasheet Anti ZNF846 pAb (ATL-HPA034617) Datasheet (External Link)
Vendor Page Anti ZNF846 pAb (ATL-HPA034617)