Anti ZNF789 pAb (ATL-HPA029500)

Atlas Antibodies

Catalog No.:
ATL-HPA029500-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 789
Gene Name: ZNF789
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037007: 41%, ENSRNOG00000005009: 41%
Entrez Gene ID: 285989
Uniprot ID: Q5FWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGKPFNQRSLLLGHERILTRAKSYECSECGKVIRRKAWFDQHQRIHF
Gene Sequence CRLTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGKPFNQRSLLLGHERILTRAKSYECSECGKVIRRKAWFDQHQRIHF
Gene ID - Mouse ENSMUSG00000037007
Gene ID - Rat ENSRNOG00000005009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF789 pAb (ATL-HPA029500)
Datasheet Anti ZNF789 pAb (ATL-HPA029500) Datasheet (External Link)
Vendor Page Anti ZNF789 pAb (ATL-HPA029500) at Atlas Antibodies

Documents & Links for Anti ZNF789 pAb (ATL-HPA029500)
Datasheet Anti ZNF789 pAb (ATL-HPA029500) Datasheet (External Link)
Vendor Page Anti ZNF789 pAb (ATL-HPA029500)