Anti ZNF772 pAb (ATL-HPA031312)

Atlas Antibodies

Catalog No.:
ATL-HPA031312-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 772
Gene Name: ZNF772
Alternative Gene Name: DKFZp686I1569
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002266: 32%, ENSRNOG00000015071: 32%
Entrez Gene ID: 400720
Uniprot ID: Q68DY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCG
Gene Sequence KPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCG
Gene ID - Mouse ENSMUSG00000002266
Gene ID - Rat ENSRNOG00000015071
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF772 pAb (ATL-HPA031312)
Datasheet Anti ZNF772 pAb (ATL-HPA031312) Datasheet (External Link)
Vendor Page Anti ZNF772 pAb (ATL-HPA031312) at Atlas Antibodies

Documents & Links for Anti ZNF772 pAb (ATL-HPA031312)
Datasheet Anti ZNF772 pAb (ATL-HPA031312) Datasheet (External Link)
Vendor Page Anti ZNF772 pAb (ATL-HPA031312)