Anti ZNF749 pAb (ATL-HPA042082)

Atlas Antibodies

Catalog No.: ATL-HPA042082-25

Protein Description: zinc finger protein 749
Gene Name: ZNF749
Alternative Gene Name: FLJ16360
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061371: 43%, ENSRNOG00000006958: 47%
Entrez Gene ID: 388567
Uniprot ID: O43361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSEGFLSKRSDPIEHQEILSRPTPYECTQC
• Gene Sequence: HSEGFLSKRSDPIEHQEILSRPTPYECTQC
• Gene ID - Mouse: ENSMUSG00000061371
• Gene ID - Rat: ENSRNOG00000006958
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.