Anti ZNF720 pAb (ATL-HPA041570)

Atlas Antibodies

Catalog No.:
ATL-HPA041570-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 720
Gene Name: ZNF720
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033883: 34%, ENSRNOG00000042283: 33%
Entrez Gene ID: 124411
Uniprot ID: Q7Z2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEGKCEGHNGYYDGHTKCKTTTYNKNLTVTGGQKHEKTQFMSVAFSKPCVSVSKCQHQFLKLTFSFKGNLDNPNSDLVHVSNNHLNQ
Gene Sequence SEGKCEGHNGYYDGHTKCKTTTYNKNLTVTGGQKHEKTQFMSVAFSKPCVSVSKCQHQFLKLTFSFKGNLDNPNSDLVHVSNNHLNQ
Gene ID - Mouse ENSMUSG00000033883
Gene ID - Rat ENSRNOG00000042283
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF720 pAb (ATL-HPA041570)
Datasheet Anti ZNF720 pAb (ATL-HPA041570) Datasheet (External Link)
Vendor Page Anti ZNF720 pAb (ATL-HPA041570) at Atlas Antibodies

Documents & Links for Anti ZNF720 pAb (ATL-HPA041570)
Datasheet Anti ZNF720 pAb (ATL-HPA041570) Datasheet (External Link)
Vendor Page Anti ZNF720 pAb (ATL-HPA041570)