Anti ZNF668 pAb (ATL-HPA043048)

Atlas Antibodies

Catalog No.: ATL-HPA043048-25

Protein Description: zinc finger protein 668
Gene Name: ZNF668
Alternative Gene Name: FLJ13479
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049728: 81%, ENSRNOG00000016683: 81%
Entrez Gene ID: 79759
Uniprot ID: Q96K58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEVEAAEARSPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGPADCSEEVAEVKPKPETEAKAEEASGEKVSGSAAKPRP
• Gene Sequence: MEVEAAEARSPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGPADCSEEVAEVKPKPETEAKAEEASGEKVSGSAAKPRP
• Gene ID - Mouse: ENSMUSG00000049728
• Gene ID - Rat: ENSRNOG00000016683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF668 pAb (ATL-HPA043048) – 1 Found

Zhang, Xiupeng; Jiang, Guiyang; Wu, Jingjing; Zhou, Haijing; Zhang, Yong; Miao, Yuan; Feng, Yangyang; Yu, Juanhan. Zinc finger protein 668 suppresses non-small cell lung cancer invasion and migration by downregulating Snail and upregulating E-cadherin and zonula occludens-1. Oncology Letters. 2018;15(3):3806-3813.