Anti ZNF662 pAb (ATL-HPA040377)

Atlas Antibodies

Catalog No.:
ATL-HPA040377-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 662
Gene Name: ZNF662
Alternative Gene Name: FLJ45880
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057551: 26%, ENSRNOG00000060129: 26%
Entrez Gene ID: 389114
Uniprot ID: Q6ZS27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPWCSVPRGALDGEAPRGISSGYPFLKPAGISHPEQVEEPLNLKLQGEGPSLICPEGVLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCG
Gene Sequence TPWCSVPRGALDGEAPRGISSGYPFLKPAGISHPEQVEEPLNLKLQGEGPSLICPEGVLKRKKEDFILKEEIIEEAQDLMVLSSGPQWCG
Gene ID - Mouse ENSMUSG00000057551
Gene ID - Rat ENSRNOG00000060129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF662 pAb (ATL-HPA040377)
Datasheet Anti ZNF662 pAb (ATL-HPA040377) Datasheet (External Link)
Vendor Page Anti ZNF662 pAb (ATL-HPA040377) at Atlas Antibodies

Documents & Links for Anti ZNF662 pAb (ATL-HPA040377)
Datasheet Anti ZNF662 pAb (ATL-HPA040377) Datasheet (External Link)
Vendor Page Anti ZNF662 pAb (ATL-HPA040377)