Anti ZNF662 pAb (ATL-HPA039116)

Atlas Antibodies

Catalog No.: ATL-HPA039116-25

Protein Description: zinc finger protein 662
Gene Name: ZNF662
Alternative Gene Name: FLJ45880
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 25%, ENSRNOG00000010744: 25%
Entrez Gene ID: 389114
Uniprot ID: Q6ZS27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQI
• Gene Sequence: SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQI
• Gene ID - Mouse: ENSMUSG00000026674
• Gene ID - Rat: ENSRNOG00000010744
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.