Anti ZNF662 pAb (ATL-HPA039116)

Atlas Antibodies

Catalog No.:
ATL-HPA039116-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 662
Gene Name: ZNF662
Alternative Gene Name: FLJ45880
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 25%, ENSRNOG00000010744: 25%
Entrez Gene ID: 389114
Uniprot ID: Q6ZS27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQI
Gene Sequence SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQI
Gene ID - Mouse ENSMUSG00000026674
Gene ID - Rat ENSRNOG00000010744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF662 pAb (ATL-HPA039116)
Datasheet Anti ZNF662 pAb (ATL-HPA039116) Datasheet (External Link)
Vendor Page Anti ZNF662 pAb (ATL-HPA039116) at Atlas Antibodies

Documents & Links for Anti ZNF662 pAb (ATL-HPA039116)
Datasheet Anti ZNF662 pAb (ATL-HPA039116) Datasheet (External Link)
Vendor Page Anti ZNF662 pAb (ATL-HPA039116)