Anti ZNF622 pAb (ATL-HPA036514)

Atlas Antibodies

Catalog No.: ATL-HPA036514-25

Protein Description: zinc finger protein 622
Gene Name: ZNF622
Alternative Gene Name: MGC17552, MGC2485, ZPR9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052253: 96%, ENSRNOG00000059443: 96%
Entrez Gene ID: 90441
Uniprot ID: Q969S3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGE
• Gene Sequence: VAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGE
• Gene ID - Mouse: ENSMUSG00000052253
• Gene ID - Rat: ENSRNOG00000059443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.