Anti ZNF573 pAb (ATL-HPA042776)

Atlas Antibodies

Catalog No.: ATL-HPA042776-25

Protein Description: zinc finger protein 573
Gene Name: ZNF573
Alternative Gene Name: FLJ30921
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091662: 35%, ENSRNOG00000055519: 38%
Entrez Gene ID: 126231
Uniprot ID: Q86YE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKK
• Gene Sequence: DLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKK
• Gene ID - Mouse: ENSMUSG00000091662
• Gene ID - Rat: ENSRNOG00000055519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.