Anti ZNF564 pAb (ATL-HPA043998)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043998-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF564
Alternative Gene Name: MGC26914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074194: 52%, ENSRNOG00000032625: 53%
Entrez Gene ID: 163050
Uniprot ID: Q8TBZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FQRHERAHNGDKPYVKNVGKLSFITQPSNTCE |
| Gene Sequence | FQRHERAHNGDKPYVKNVGKLSFITQPSNTCE |
| Gene ID - Mouse | ENSMUSG00000074194 |
| Gene ID - Rat | ENSRNOG00000032625 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF564 pAb (ATL-HPA043998) | |
| Datasheet | Anti ZNF564 pAb (ATL-HPA043998) Datasheet (External Link) |
| Vendor Page | Anti ZNF564 pAb (ATL-HPA043998) at Atlas Antibodies |
| Documents & Links for Anti ZNF564 pAb (ATL-HPA043998) | |
| Datasheet | Anti ZNF564 pAb (ATL-HPA043998) Datasheet (External Link) |
| Vendor Page | Anti ZNF564 pAb (ATL-HPA043998) |