Anti ZNF564 pAb (ATL-HPA043998)

Atlas Antibodies

Catalog No.:
ATL-HPA043998-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 564
Gene Name: ZNF564
Alternative Gene Name: MGC26914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074194: 52%, ENSRNOG00000032625: 53%
Entrez Gene ID: 163050
Uniprot ID: Q8TBZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQRHERAHNGDKPYVKNVGKLSFITQPSNTCE
Gene Sequence FQRHERAHNGDKPYVKNVGKLSFITQPSNTCE
Gene ID - Mouse ENSMUSG00000074194
Gene ID - Rat ENSRNOG00000032625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF564 pAb (ATL-HPA043998)
Datasheet Anti ZNF564 pAb (ATL-HPA043998) Datasheet (External Link)
Vendor Page Anti ZNF564 pAb (ATL-HPA043998) at Atlas Antibodies

Documents & Links for Anti ZNF564 pAb (ATL-HPA043998)
Datasheet Anti ZNF564 pAb (ATL-HPA043998) Datasheet (External Link)
Vendor Page Anti ZNF564 pAb (ATL-HPA043998)