Anti ZNF563 pAb (ATL-HPA042136)

Atlas Antibodies

Catalog No.: ATL-HPA042136-25

Protein Description: zinc finger protein 563
Gene Name: ZNF563
Alternative Gene Name: FLJ34797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066880: 44%, ENSRNOG00000032552: 41%
Entrez Gene ID: 147837
Uniprot ID: Q8TA94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLS
• Gene Sequence: SSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLS
• Gene ID - Mouse: ENSMUSG00000066880
• Gene ID - Rat: ENSRNOG00000032552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.