Anti ZNF527 pAb (ATL-HPA037741)

Atlas Antibodies

Catalog No.:
ATL-HPA037741-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 527
Gene Name: ZNF527
Alternative Gene Name: KIAA1829
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040022: 31%, ENSRNOG00000004104: 28%
Entrez Gene ID: 84503
Uniprot ID: Q8NB42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKEISTGKRDNEFSNSGRSIPLKSVFLTQQKVPTIQQVHKFDIYDKLFPQNSVIIEYKRLHAEKESLIGNE
Gene Sequence VKEISTGKRDNEFSNSGRSIPLKSVFLTQQKVPTIQQVHKFDIYDKLFPQNSVIIEYKRLHAEKESLIGNE
Gene ID - Mouse ENSMUSG00000040022
Gene ID - Rat ENSRNOG00000004104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF527 pAb (ATL-HPA037741)
Datasheet Anti ZNF527 pAb (ATL-HPA037741) Datasheet (External Link)
Vendor Page Anti ZNF527 pAb (ATL-HPA037741) at Atlas Antibodies

Documents & Links for Anti ZNF527 pAb (ATL-HPA037741)
Datasheet Anti ZNF527 pAb (ATL-HPA037741) Datasheet (External Link)
Vendor Page Anti ZNF527 pAb (ATL-HPA037741)