Anti ZNF527 pAb (ATL-HPA037740)

Atlas Antibodies

Catalog No.:
ATL-HPA037740-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 527
Gene Name: ZNF527
Alternative Gene Name: KIAA1829
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 32%, ENSRNOG00000046652: 32%
Entrez Gene ID: 84503
Uniprot ID: Q8NB42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVWLDWESWCEIEELSPKWFIDEDEISQEMVMERLASHGLECSSFREAWKYKGEFELHQGNAERHFMQVTA
Gene Sequence LVWLDWESWCEIEELSPKWFIDEDEISQEMVMERLASHGLECSSFREAWKYKGEFELHQGNAERHFMQVTA
Gene ID - Mouse ENSMUSG00000099689
Gene ID - Rat ENSRNOG00000046652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF527 pAb (ATL-HPA037740)
Datasheet Anti ZNF527 pAb (ATL-HPA037740) Datasheet (External Link)
Vendor Page Anti ZNF527 pAb (ATL-HPA037740) at Atlas Antibodies

Documents & Links for Anti ZNF527 pAb (ATL-HPA037740)
Datasheet Anti ZNF527 pAb (ATL-HPA037740) Datasheet (External Link)
Vendor Page Anti ZNF527 pAb (ATL-HPA037740)