Anti ZNF518B pAb (ATL-HPA031216)

Atlas Antibodies

Catalog No.:
ATL-HPA031216-25
Immunohistochemical staining of human kidney shows strong nuclear positivity in renal tubules.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
ChIP-Exo-Seq composite graph for Anti-ZNF518B (HPA031216, Lot R30464) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 518B
Gene Name: ZNF518B
Alternative Gene Name: KIAA1729
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046572: 68%, ENSRNOG00000028534: 66%
Entrez Gene ID: 85460
Uniprot ID: Q9C0D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATPVLIPKGAVLRVLNSSENAHIIEATCEAPVSIPCSERQLIKPVPFCPVRQADSDLQPLRSERGPIDMSPNIETPLRPKLRKESAVCSTIH
Gene Sequence ATPVLIPKGAVLRVLNSSENAHIIEATCEAPVSIPCSERQLIKPVPFCPVRQADSDLQPLRSERGPIDMSPNIETPLRPKLRKESAVCSTIH
Gene ID - Mouse ENSMUSG00000046572
Gene ID - Rat ENSRNOG00000028534
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF518B pAb (ATL-HPA031216)
Datasheet Anti ZNF518B pAb (ATL-HPA031216) Datasheet (External Link)
Vendor Page Anti ZNF518B pAb (ATL-HPA031216) at Atlas Antibodies

Documents & Links for Anti ZNF518B pAb (ATL-HPA031216)
Datasheet Anti ZNF518B pAb (ATL-HPA031216) Datasheet (External Link)
Vendor Page Anti ZNF518B pAb (ATL-HPA031216)
Citations for Anti ZNF518B pAb (ATL-HPA031216) – 2 Found
Gimeno-Valiente, Francisco; Riffo-Campos, Ángela L; Vallet-Sánchez, Azahara; Siscar-Lewin, Sofía; Gambardella, Valentina; Tarazona, Noelia; Cervantes, Andrés; Franco, Luis; Castillo, Josefa; López-Rodas, Gerardo. ZNF518B gene up-regulation promotes dissemination of tumour cells and is governed by epigenetic mechanisms in colorectal cancer. Scientific Reports. 2019;9(1):9339.  PubMed
Gimeno-Valiente, Francisco; Riffo-Campos, Ángela L; Torres, Luis; Tarazona, Noelia; Gambardella, Valentina; Cervantes, Andrés; López-Rodas, Gerardo; Franco, Luis; Castillo, Josefa. Epigenetic Mechanisms Are Involved in the Oncogenic Properties of ZNF518B in Colorectal Cancer. Cancers. 2021;13(6)  PubMed
!