Anti ZNF511 pAb (ATL-HPA035360)

Atlas Antibodies

Catalog No.:
ATL-HPA035360-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 511
Gene Name: ZNF511
Alternative Gene Name: MGC30006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025470: 51%, ENSRNOG00000018272: 45%
Entrez Gene ID: 118472
Uniprot ID: Q8NB15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRMHLYPADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRSVSELFLKP
Gene Sequence VRMHLYPADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAGERRIYRHRSVSELFLKP
Gene ID - Mouse ENSMUSG00000025470
Gene ID - Rat ENSRNOG00000018272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF511 pAb (ATL-HPA035360)
Datasheet Anti ZNF511 pAb (ATL-HPA035360) Datasheet (External Link)
Vendor Page Anti ZNF511 pAb (ATL-HPA035360) at Atlas Antibodies

Documents & Links for Anti ZNF511 pAb (ATL-HPA035360)
Datasheet Anti ZNF511 pAb (ATL-HPA035360) Datasheet (External Link)
Vendor Page Anti ZNF511 pAb (ATL-HPA035360)