Anti ZNF350 pAb (ATL-HPA001521)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001521-100
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/80510/146305/atl-hpa001521_anti-znf350-pab-atl-hpa001521_27928__07334.1681094991.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue")
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: ZNF350
Alternative Gene Name: ZBRK1, ZFQR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017667: 25%, ENSRNOG00000042181: 25%
Entrez Gene ID: 59348
Uniprot ID: Q9GZX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ |
| Gene Sequence | FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ |
| Gene ID - Mouse | ENSMUSG00000017667 |
| Gene ID - Rat | ENSRNOG00000042181 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF350 pAb (ATL-HPA001521) | |
| Datasheet | Anti ZNF350 pAb (ATL-HPA001521) Datasheet (External Link) |
| Vendor Page | Anti ZNF350 pAb (ATL-HPA001521) at Atlas Antibodies |
| Documents & Links for Anti ZNF350 pAb (ATL-HPA001521) | |
| Datasheet | Anti ZNF350 pAb (ATL-HPA001521) Datasheet (External Link) |
| Vendor Page | Anti ZNF350 pAb (ATL-HPA001521) |
| Citations for Anti ZNF350 pAb (ATL-HPA001521) – 1 Found |
| Hallen, Linda; Klein, Holger; Stoschek, Carola; Wehrmeyer, Silke; Nonhoff, Ute; Ralser, Markus; Wilde, Jeannine; Röhr, Christina; Schweiger, Michal R; Zatloukal, Kurt; Vingron, Martin; Lehrach, Hans; Konthur, Zoltán; Krobitsch, Sylvia. The KRAB-containing zinc-finger transcriptional regulator ZBRK1 activates SCA2 gene transcription through direct interaction with its gene product, ataxin-2. Human Molecular Genetics. 2011;20(1):104-14. PubMed |