Anti ZNF347 pAb (ATL-HPA023448)

Atlas Antibodies

Catalog No.: ATL-HPA023448-25

Protein Description: zinc finger protein 347
Gene Name: ZNF347
Alternative Gene Name: ZNF1111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038535: 25%, ENSRNOG00000034184: 28%
Entrez Gene ID: 84671
Uniprot ID: Q96SE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGISCFDLSIISMLEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVM
• Gene Sequence: LGISCFDLSIISMLEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVM
• Gene ID - Mouse: ENSMUSG00000038535
• Gene ID - Rat: ENSRNOG00000034184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.