Anti ZNF326 pAb (ATL-HPA028450)

Atlas Antibodies

Catalog No.:
ATL-HPA028450-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 326
Gene Name: ZNF326
Alternative Gene Name: FLJ20403, ZAN75, Zfp326, ZIRD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029290: 98%, ENSRNOG00000047761: 98%
Entrez Gene ID: 284695
Uniprot ID: Q5BKZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSS
Gene Sequence FNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSS
Gene ID - Mouse ENSMUSG00000029290
Gene ID - Rat ENSRNOG00000047761
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF326 pAb (ATL-HPA028450)
Datasheet Anti ZNF326 pAb (ATL-HPA028450) Datasheet (External Link)
Vendor Page Anti ZNF326 pAb (ATL-HPA028450) at Atlas Antibodies

Documents & Links for Anti ZNF326 pAb (ATL-HPA028450)
Datasheet Anti ZNF326 pAb (ATL-HPA028450) Datasheet (External Link)
Vendor Page Anti ZNF326 pAb (ATL-HPA028450)