Anti ZNF322 pAb (ATL-HPA043161)

Atlas Antibodies

Catalog No.:
ATL-HPA043161-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 322
Gene Name: ZNF322
Alternative Gene Name: bA457M11.2, bA457M11.3, HCG12, ZNF322A, ZNF388, ZNF489
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046351: 91%, ENSRNOG00000017318: 91%
Entrez Gene ID: 79692
Uniprot ID: Q6U7Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCD
Gene Sequence QRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCD
Gene ID - Mouse ENSMUSG00000046351
Gene ID - Rat ENSRNOG00000017318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF322 pAb (ATL-HPA043161)
Datasheet Anti ZNF322 pAb (ATL-HPA043161) Datasheet (External Link)
Vendor Page Anti ZNF322 pAb (ATL-HPA043161) at Atlas Antibodies

Documents & Links for Anti ZNF322 pAb (ATL-HPA043161)
Datasheet Anti ZNF322 pAb (ATL-HPA043161) Datasheet (External Link)
Vendor Page Anti ZNF322 pAb (ATL-HPA043161)