Anti ZNF320 pAb (ATL-HPA043696)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043696-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF320
Alternative Gene Name: DKFZp686G16228, ZFPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030486: 50%, ENSRNOG00000032625: 50%
Entrez Gene ID: 162967
Uniprot ID: A2RRD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI |
| Gene Sequence | GKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI |
| Gene ID - Mouse | ENSMUSG00000030486 |
| Gene ID - Rat | ENSRNOG00000032625 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF320 pAb (ATL-HPA043696) | |
| Datasheet | Anti ZNF320 pAb (ATL-HPA043696) Datasheet (External Link) |
| Vendor Page | Anti ZNF320 pAb (ATL-HPA043696) at Atlas Antibodies |
| Documents & Links for Anti ZNF320 pAb (ATL-HPA043696) | |
| Datasheet | Anti ZNF320 pAb (ATL-HPA043696) Datasheet (External Link) |
| Vendor Page | Anti ZNF320 pAb (ATL-HPA043696) |