Anti ZNF320 pAb (ATL-HPA043696)

Atlas Antibodies

Catalog No.: ATL-HPA043696-25

Protein Description: zinc finger protein 320
Gene Name: ZNF320
Alternative Gene Name: DKFZp686G16228, ZFPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030486: 50%, ENSRNOG00000032625: 50%
Entrez Gene ID: 162967
Uniprot ID: A2RRD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI
• Gene Sequence: GKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI
• Gene ID - Mouse: ENSMUSG00000030486
• Gene ID - Rat: ENSRNOG00000032625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.