Anti ZNF250 pAb (ATL-HPA020853)

Atlas Antibodies

Catalog No.:
ATL-HPA020853-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 250
Gene Name: ZNF250
Alternative Gene Name: MGC9718, ZFP647, ZNF647
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054967: 43%, ENSRNOG00000050651: 51%
Entrez Gene ID: 58500
Uniprot ID: P15622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSH
Gene Sequence SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSH
Gene ID - Mouse ENSMUSG00000054967
Gene ID - Rat ENSRNOG00000050651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF250 pAb (ATL-HPA020853)
Datasheet Anti ZNF250 pAb (ATL-HPA020853) Datasheet (External Link)
Vendor Page Anti ZNF250 pAb (ATL-HPA020853) at Atlas Antibodies

Documents & Links for Anti ZNF250 pAb (ATL-HPA020853)
Datasheet Anti ZNF250 pAb (ATL-HPA020853) Datasheet (External Link)
Vendor Page Anti ZNF250 pAb (ATL-HPA020853)