Anti ZNF250 pAb (ATL-HPA020853)

Atlas Antibodies

Catalog No.: ATL-HPA020853-25

Protein Description: zinc finger protein 250
Gene Name: ZNF250
Alternative Gene Name: MGC9718, ZFP647, ZNF647
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054967: 43%, ENSRNOG00000050651: 51%
Entrez Gene ID: 58500
Uniprot ID: P15622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSH
• Gene Sequence: SPKPLISEQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGRSSH
• Gene ID - Mouse: ENSMUSG00000054967
• Gene ID - Rat: ENSRNOG00000050651
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.