Anti ZNF24 pAb (ATL-HPA024062)

Atlas Antibodies

Catalog No.: ATL-HPA024062-25

Protein Description: zinc finger protein 24
Gene Name: ZNF24
Alternative Gene Name: KOX17, Zfp191, ZNF191, ZSCAN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051469: 89%, ENSRNOG00000016562: 91%
Entrez Gene ID: 7572
Uniprot ID: P17028
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS
• Gene Sequence: LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS
• Gene ID - Mouse: ENSMUSG00000051469
• Gene ID - Rat: ENSRNOG00000016562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF24 pAb (ATL-HPA024062) – 2 Found

Huang, Xiangjiang; Liu, Nanxin; Xiong, Xing. ZNF24 is upregulated in prostate cancer and facilitates the epithelial-to-mesenchymal transition through the regulation of Twist1. Oncology Letters. 2020;19(5):3593-3601. 

Liu, Lu; Lei, Yuxi; Chen, Wensheng; Zhou, Qian; Zheng, Zongyao; Zeng, Guandi; Liu, Wanting; Feng, Pengju; Zhang, Zhiyi; Yu, Lei; Chen, Liang. In vivo genome-wide CRISPR screening identifies ZNF24 as a negative NF-κB modulator in lung cancer. Cell & Bioscience. 2022;12(1):193.