Anti ZNF2 pAb (ATL-HPA041358)

Atlas Antibodies

Catalog No.:
ATL-HPA041358-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 2
Gene Name: ZNF2
Alternative Gene Name: A1-5, Zfp661, ZNF661
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034800: 53%, ENSRNOG00000015188: 51%
Entrez Gene ID: 7549
Uniprot ID: Q9BSG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRR
Gene Sequence LDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRR
Gene ID - Mouse ENSMUSG00000034800
Gene ID - Rat ENSRNOG00000015188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF2 pAb (ATL-HPA041358)
Datasheet Anti ZNF2 pAb (ATL-HPA041358) Datasheet (External Link)
Vendor Page Anti ZNF2 pAb (ATL-HPA041358) at Atlas Antibodies

Documents & Links for Anti ZNF2 pAb (ATL-HPA041358)
Datasheet Anti ZNF2 pAb (ATL-HPA041358) Datasheet (External Link)
Vendor Page Anti ZNF2 pAb (ATL-HPA041358)