Anti ZNF181 pAb (ATL-HPA043701)

Atlas Antibodies

Catalog No.:
ATL-HPA043701-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 181
Gene Name: ZNF181
Alternative Gene Name: HHZ181, MGC44316
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074221: 36%, ENSRNOG00000013673: 29%
Entrez Gene ID: 339318
Uniprot ID: Q2M3W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKNLEYIEKLEGKHGSQVDHFRPAILTSRESPTADSVYKYNI
Gene Sequence KKNLEYIEKLEGKHGSQVDHFRPAILTSRESPTADSVYKYNI
Gene ID - Mouse ENSMUSG00000074221
Gene ID - Rat ENSRNOG00000013673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF181 pAb (ATL-HPA043701)
Datasheet Anti ZNF181 pAb (ATL-HPA043701) Datasheet (External Link)
Vendor Page Anti ZNF181 pAb (ATL-HPA043701) at Atlas Antibodies

Documents & Links for Anti ZNF181 pAb (ATL-HPA043701)
Datasheet Anti ZNF181 pAb (ATL-HPA043701) Datasheet (External Link)
Vendor Page Anti ZNF181 pAb (ATL-HPA043701)