Anti ZNF124 pAb (ATL-HPA031127)

Atlas Antibodies

Catalog No.: ATL-HPA031127-25

Protein Description: zinc finger protein 124
Gene Name: ZNF124
Alternative Gene Name: HZF-16, HZF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074472: 47%, ENSRNOG00000050600: 51%
Entrez Gene ID: 7678
Uniprot ID: Q15973
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIHQRN
• Gene Sequence: PCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIHQRN
• Gene ID - Mouse: ENSMUSG00000074472
• Gene ID - Rat: ENSRNOG00000050600
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.