Anti ZFPL1 pAb (ATL-HPA014909 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014909-25

Protein Description: zinc finger protein-like 1
Gene Name: ZFPL1
Alternative Gene Name: D11S750, MCG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024792: 83%, ENSRNOG00000050180: 83%
Entrez Gene ID: 7542
Uniprot ID: O95159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKR
• Gene Sequence: DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKR
• Gene ID - Mouse: ENSMUSG00000024792
• Gene ID - Rat: ENSRNOG00000050180
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZFPL1 pAb (ATL-HPA014909 w/enhanced validation) – 5 Found

Wong, Mie; Gillingham, Alison K; Munro, Sean. The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs. Bmc Biology. 2017;15(1):3. 

Navarro Negredo, Paloma; Edgar, James R; Manna, Paul T; Antrobus, Robin; Robinson, Margaret S. The WDR11 complex facilitates the tethering of AP-1-derived vesicles. Nature Communications. 2018;9(1):596. 

Gillingham, Alison K; Bertram, Jessie; Begum, Farida; Munro, Sean. In vivo identification of GTPase interactors by mitochondrial relocalization and proximity biotinylation. Elife. 2019;8( 31294692) 

Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898. 

Stewart, Hazel; Palmulli, Roberta; Johansen, Kristoffer H; McGovern, Naomi; Shehata, Ola M; Carnell, George W; Jackson, Hannah K; Lee, Jin S; Brown, Jonathan C; Burgoyne, Thomas; Heeney, Jonathan L; Okkenhaug, Klaus; Firth, Andrew E; Peden, Andrew A; Edgar, James R. Tetherin antagonism by SARS-CoV-2 enhances virus release: multiple mechanisms including ORF3a-mediated defective retrograde traffic. Biorxiv : The Preprint Server For Biology. 2022; 33442692( 33442692)