Anti ZFAND2B pAb (ATL-HPA035159)

Atlas Antibodies

Catalog No.:
ATL-HPA035159-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: zinc finger, AN1-type domain 2B
Gene Name: ZFAND2B
Alternative Gene Name: AIRAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026197: 89%, ENSRNOG00000018639: 91%
Entrez Gene ID: 130617
Uniprot ID: Q8WV99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC
Gene Sequence NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC
Gene ID - Mouse ENSMUSG00000026197
Gene ID - Rat ENSRNOG00000018639
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFAND2B pAb (ATL-HPA035159)
Datasheet Anti ZFAND2B pAb (ATL-HPA035159) Datasheet (External Link)
Vendor Page Anti ZFAND2B pAb (ATL-HPA035159) at Atlas Antibodies

Documents & Links for Anti ZFAND2B pAb (ATL-HPA035159)
Datasheet Anti ZFAND2B pAb (ATL-HPA035159) Datasheet (External Link)
Vendor Page Anti ZFAND2B pAb (ATL-HPA035159)