Anti ZFAND2B pAb (ATL-HPA035159)

Atlas Antibodies

Catalog No.: ATL-HPA035159-100

Protein Description: zinc finger, AN1-type domain 2B
Gene Name: ZFAND2B
Alternative Gene Name: AIRAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026197: 89%, ENSRNOG00000018639: 91%
Entrez Gene ID: 130617
Uniprot ID: Q8WV99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC
• Gene Sequence: NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC
• Gene ID - Mouse: ENSMUSG00000026197
• Gene ID - Rat: ENSRNOG00000018639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.