Anti ZBTB45 pAb (ATL-HPA035754)

Atlas Antibodies

Catalog No.: ATL-HPA035754-25

Protein Description: zinc finger and BTB domain containing 45
Gene Name: ZBTB45
Alternative Gene Name: FLJ14486, ZNF499
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049600: 79%, ENSRNOG00000027459: 79%
Entrez Gene ID: 84878
Uniprot ID: Q96K62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTYECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCW
• Gene Sequence: PTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTYECSHCRKTFSSRKNYTKHMFIHSGEKPHQCAVCW
• Gene ID - Mouse: ENSMUSG00000049600
• Gene ID - Rat: ENSRNOG00000027459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.