Anti ZBTB34 pAb (ATL-HPA023893)

Atlas Antibodies

Catalog No.:
ATL-HPA023893-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger and BTB domain containing 34
Gene Name: ZBTB34
Alternative Gene Name: KIAA1993, MGC24652, ZNF918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068966: 96%, ENSRNOG00000032700: 96%
Entrez Gene ID: 403341
Uniprot ID: Q8NCN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAA
Gene Sequence GSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAA
Gene ID - Mouse ENSMUSG00000068966
Gene ID - Rat ENSRNOG00000032700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBTB34 pAb (ATL-HPA023893)
Datasheet Anti ZBTB34 pAb (ATL-HPA023893) Datasheet (External Link)
Vendor Page Anti ZBTB34 pAb (ATL-HPA023893) at Atlas Antibodies

Documents & Links for Anti ZBTB34 pAb (ATL-HPA023893)
Datasheet Anti ZBTB34 pAb (ATL-HPA023893) Datasheet (External Link)
Vendor Page Anti ZBTB34 pAb (ATL-HPA023893)