Anti ZADH2 pAb (ATL-HPA021468 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021468-25

Protein Description: zinc binding alcohol dehydrogenase domain containing 2
Gene Name: ZADH2
Alternative Gene Name: MGC45594
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049090: 94%, ENSRNOG00000016239: 92%
Entrez Gene ID: 284273
Uniprot ID: Q8N4Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPS
• Gene Sequence: RLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPS
• Gene ID - Mouse: ENSMUSG00000049090
• Gene ID - Rat: ENSRNOG00000016239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.