Anti YTHDC2 pAb (ATL-HPA037364)

Atlas Antibodies

Catalog No.: ATL-HPA037364-25

Protein Description: YTH domain containing 2
Gene Name: YTHDC2
Alternative Gene Name: DKFZp564A186, FLJ10053, FLJ2194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034653: 94%, ENSRNOG00000039241: 97%
Entrez Gene ID: 64848
Uniprot ID: Q9H6S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRKSSADTEFSDECTTAERVLMKSPSPALHP
• Gene Sequence: APSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRKSSADTEFSDECTTAERVLMKSPSPALHP
• Gene ID - Mouse: ENSMUSG00000034653
• Gene ID - Rat: ENSRNOG00000039241
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YTHDC2 pAb (ATL-HPA037364) – 3 Found

Kretschmer, Jens; Rao, Harita; Hackert, Philipp; Sloan, Katherine E; Höbartner, Claudia; Bohnsack, Markus T. The m(6)A reader protein YTHDC2 interacts with the small ribosomal subunit and the 5'-3' exoribonuclease XRN1. Rna (New York, N.y.). 2018;24(10):1339-1350. 

McGlacken-Byrne, Sinéad M; Del Valle, Ignacio; Quesne Stabej, Polona Le; Bellutti, Laura; Garcia-Alonso, Luz; Ocaka, Louise A; Ishida, Miho; Suntharalingham, Jenifer P; Gagunashvili, Andrey; Ogunbiyi, Olumide K; Mistry, Talisa; Buonocore, Federica; Crespo, Berta; Moreno, Nadjeda; Niola, Paola; Brooks, Tony; Brain, Caroline E; Dattani, Mehul T; Kelberman, Daniel; Vento-Tormo, Roser; Lagos, Carlos F; Livera, Gabriel; Conway, Gerard S; Achermann, John C. Pathogenic variants in the human m6A reader YTHDC2 are associated with primary ovarian insufficiency. Jci Insight. 2022;7(5) 

He, Jun-Ju; Li, Zhi; Rong, Zhuo-Xian; Gao, Jie; Mu, Yun; Guan, Yi-Di; Ren, Xin-Xin; Zi, Yu-Yuan; Liu, Li-Yu; Fan, Qi; Zhou, Ming; Duan, Yu-Mei; Zhou, Qin; Deng, Yue-Zhen; Sun, Lun-Quan. m(6)A Reader YTHDC2 Promotes Radiotherapy Resistance of Nasopharyngeal Carcinoma via Activating IGF1R/AKT/S6 Signaling Axis. Frontiers In Oncology. 10( 32850334):1166.